PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GRAS
Protein Properties Length: 698aa    MW: 76486.7 Da    PI: 5.5993
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0854genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS324.81.7e-993416972374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++L+++Ae +++gd  laq +Larl+++ sp g+p+ R+a+yf+eAL+  l        ++ ++s  s++n++ ++ a+k fse+sPi++f+++t+N
  Gh_A12G0854 341 IDQLIQAAELIETGDPVLAQGILARLNHQLSPVGKPFIRAAFYFKEALQLLLPL------NTSNTSVMSNYNMIFKIGAYKSFSEISPIVQFANFTCN 432
                  689**********************************************99998......666777778888************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl.eleeLrv 196
                  qa+le +eg++r+HiiDfd+++G+QW++L+q+L  R++g+ps++iT+++sp+s++  el  t e+L+++A+e++++f+++++  ++l++   +  L++
  Gh_A12G0854 433 QALLEVFEGCNRLHIIDFDVGYGGQWASLMQELVLRNGGAPSMKITAFASPSSHDDIELGFTIENLKHYASEINMDFDIEIMSLEALNSGsWPLPLHL 530
                  *********************************************************************************85555554413556799 PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                   ++Ea+aVnl +  ++ +      +s  + vL++vk+lsPk+vv  ++ +d+++ +F +++++al+ ys l++sl+a    + ++  k+Er++l+++i
  Gh_A12G0854 531 GENEAIAVNLPIGSFSNY------PSILPLVLRFVKQLSPKIVVSLDRGCDRTDVPFPHHIIHALQSYSGLLESLDAV-NMNLDALEKIERFFLQPSI 621
                  99**********888877......455568*********************************************766.45669999*********** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++v  ++++     e+   Wr+ + ++GF+p+++s+++++qa++l+++++ +g++ve+++ slvl+W++r+L+++SaWr
  Gh_A12G0854 622 EKIVLGRHRS----LERRPPWRSLFIQSGFSPLTFSNFTESQAECLIQRTPIRGFHVEKRQSSLVLCWQRRELIAASAWR 697
                  *****99998....88889************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.158314677IPR005202Transcription factor GRAS
PfamPF035146.0E-97341697IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MKAMPLSFEE FQGKGALDFS SSTSSCSDSS LLLQHQHQQH EKEGKWQNKG GDCCYVGSEP  60
IDNNIKTGRK RSPSPSSTLS SSLGGGGSGG GASTDTTGVA ATTTVVSATT NTSQSLDVGK  120
CGLGMEDWES VLSGSPNQDQ SILRLIMGDI DDPSMGLNKI LQPPSGGGGG GSENMEFNAG  180
FGVVDHGFGF DSITSSVSLI NNVDPPISCS DFPVTSNPPS LLPPPSPCVF PQQQSQLQVM  240
DEKPQIFNPQ MIINQNQARF TQNPTMFLPL SYAQLQEHSL LSPPPPKRFN SGGPFSGSGP  300
ELYLRRQQQQ QIQMLQQRPI TGKPKIVTDD LANQQLQQAI IDQLIQAAEL IETGDPVLAQ  360
GILARLNHQL SPVGKPFIRA AFYFKEALQL LLPLNTSNTS VMSNYNMIFK IGAYKSFSEI  420
SPIVQFANFT CNQALLEVFE GCNRLHIIDF DVGYGGQWAS LMQELVLRNG GAPSMKITAF  480
ASPSSHDDIE LGFTIENLKH YASEINMDFD IEIMSLEALN SGSWPLPLHL GENEAIAVNL  540
PIGSFSNYPS ILPLVLRFVK QLSPKIVVSL DRGCDRTDVP FPHHIIHALQ SYSGLLESLD  600
AVNMNLDALE KIERFFLQPS IEKIVLGRHR SLERRPPWRS LFIQSGFSPL TFSNFTESQA  660
ECLIQRTPIR GFHVEKRQSS LVLCWQRREL IAASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-333406974375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.236720.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5274720.0HQ527472.1 Gossypium herbaceum clone NBRI_A_6925 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437503.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813161e-173SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A0D2RD940.0A0A0D2RD94_G
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-155GRAS family protein